PACAP 1-27
Synonym(s):PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem;PACAP-27;Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂
- CAS NO.：127317-03-7
- Empirical Formula: C142H224N40O39S
- Molecular Weight: 3147.61
- MDL number: MFCD00167418
- SAFETY DATA SHEET (SDS)
- Update Date: 2025-10-23 17:25:30
What is PACAP 1-27?
The Uses of PACAP 1-27
Pituitary Adenylate Cyclase-Activating Polypeptide 1-27 (PACAP 1-27) is a neuropeptide that stimulates adenylyl cyclase.
Biological Functions
PACAP 1-27 is an endogenous neuropeptide and is the C-terminally truncated form of PACAP 38. PACAP 27 has considerable homology with vasoactive intestinal peptide (VIP) but is >100 fold more potent than VIP as an agonist of the PAC1 receptor. PACAP 27 functions in the control of anterior pituitary hormone secretion, vasodilation, adrenaline secretion, insulin secretion and immunosuppression.
Biological Activity
PACAP 1-27, also known as PACAP 27 Amide, is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). Potently stimulates adenylyl cyclase.
Storage
Store at -20°C
Properties of PACAP 1-27
| Density | 1.45±0.1 g/cm3(Predicted) |
| storage temp. | −20°C |
| solubility | H2OPeptide Solubility and Storage Guidelines:1.??Calculate the length of the peptide.2.??Calculate the overall charge of the entire peptide according to the following table:3.??Recommended solution: |
| form | solid |
| color | white |
| Water Solubility | Soluble to 1 mg/ml in water |
Safety information for PACAP 1-27
Computed Descriptors for PACAP 1-27
| InChIKey | RZGBUJXSKLDAFE-XVTUQGJWNA-N |
New Products
Boc-N-Me-Val-OH tert-butyl 9-methoxy-3-azaspiro[5.5]undecane-3-carboxylate Indole Methyl Resin Gabapentin EP Impurity B Ethyl N-(2- cyanoacetyl)carbamate Magnessium Ascorbate 1-Chloro-4-Methyl-2-Nitrobenzene 1,3-Diethyl-1,3-Diphenylurea 3-(4-morpholinophenylamino)-5-amino-1H-pyrazole-4-carbonitrile Methyl 2-methylquinoline-6-carboxylate 2,4-dihydroxybenzaldehyde 2-((4-morpholinophenylamino) (methylthio) methylene) malononitrile Benzethonium Chloride Trenbolone Enanthate Prednisolone acetate Cisplatin Chlorodehydromethyl testosterone Ketoconazole 1,3-Di Iodo Benzene Methyl 2-oxo-2,3-dihydrobenzo[d]oxazole-7-carboxylate 3-Hydroxy-4-nitrobromobenzene 4-(2-Aminoethyl)-7-hydroxy-2H-chromoen-2-one 2-Ethyl-1,4-diaminobenzene 2-Ethylhexyl 4-aminobenzoateRelated products of tetrahydrofuran
You may like
-
PACAP 27 Amide, Ovine CAS 127317-03-7View Details
127317-03-7 -
tert-butyl 9-methoxy-3-azaspiro[5.5]undecane-3-carboxylate 98%View Details
2640989-54-2 -
Indole Ethyl Resin 98%View Details
-
Indole Methyl Resin 98%View Details
-
N,N-Dicyclohexylcarbodiimide(DCC) 99%View Details
538-75-0 -
Boc-L-Ala-OH >98%View Details
15761-38-3 -
2-Methoxyphenothiazine >98%View Details
1771-18-2 -
31972-52-8 >95%View Details
31972-52-8
Statement: All products displayed on this website are only used for non medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.