Contact us: +91 9550333722 040 - 40102781
Structured search
India
Choose your country
Different countries will display different contents
Try our best to find the right business for you.
My chemicalbook

Welcome back!

HomeProduct name listPACAP 1-27

PACAP 1-27

Synonym(s):PACAP 27 Amide, Ovine - CAS 127317-03-7 - Calbiochem;PACAP-27;Pituitary Adenylate Cyclase Activating Polypeptide, HSDGIFTDSYSRYRKQMAVKKYLAAVL-NH₂

PACAP 1-27 Structural

What is PACAP 1-27?

The Uses of PACAP 1-27

Pituitary Adenylate Cyclase-Activating Polypeptide 1-27 (PACAP 1-27) is a neuropeptide that stimulates adenylyl cyclase.

Biological Functions

PACAP 1-27 is an endogenous neuropeptide and is the C-terminally truncated form of PACAP 38. PACAP 27 has considerable homology with vasoactive intestinal peptide (VIP) but is >100 fold more potent than VIP as an agonist of the PAC1 receptor. PACAP 27 functions in the control of anterior pituitary hormone secretion, vasodilation, adrenaline secretion, insulin secretion and immunosuppression.

Biological Activity

PACAP 1-27, also known as PACAP 27 Amide, is an endogenous neuropeptide showing considerable homology with vasoactive intestinal peptide (VIP). Potently stimulates adenylyl cyclase.

Storage

Store at -20°C

Properties of PACAP 1-27

Density  1.45±0.1 g/cm3(Predicted)
storage temp.  −20°C
solubility  H2OPeptide Solubility and Storage Guidelines:1.??Calculate the length of the peptide.2.??Calculate the overall charge of the entire peptide according to the following table:3.??Recommended solution:
form  solid
color  white
Water Solubility  Soluble to 1 mg/ml in water

Safety information for PACAP 1-27

Computed Descriptors for PACAP 1-27

InChIKey RZGBUJXSKLDAFE-XVTUQGJWNA-N

Related products of tetrahydrofuran

You may like

Statement: All products displayed on this website are only used for non medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.