Amyloid β-Peptide (1-42) (human)
Synonym(s):β-Amyloid Peptide (1-42), Rat;DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
- CAS NO.:107761-42-2
- Empirical Formula: C203H311N55O60S1
- Molecular Weight: 4514.04
- MDL number: MFCD00163049
- EINECS: 761-142-2
- SAFETY DATA SHEET (SDS)
- Update Date: 2026-03-01 21:15:31
What is Amyloid β-Peptide (1-42) (human)?
Chemical properties
Lyophilized White solid, with no soy flavor, no protein denaturation, acidic non-precipitation, heating does not coagulate, easily soluble in water, good fluidity, and other good processing properties, is an excellent health food material.
The Uses of Amyloid β-Peptide (1-42) (human)
Aβ(s) peptides, their peptide fragments and mutated fragments are used to study a wide range of metabolic and regulatory functions including activation of kinases, regulation of cholesterol transport, function as a transcription factor, and regulators of inflammation. Aβ(s) peptides and their peptide fragments are also used to study oxidative stress, metal binding and mechanisms of protein cross-linking in the context of diseases such as Alzheimer?s disease and neurodegeneration.
What are the applications of Application
Amyloid beta (Aβ or Abeta) is a peptide of 36-C43 amino acids that is processed from the Amyloid precursor protein. Amyloid β-Peptide (1-42) human is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease. Beta-Amyloid (1-42) human is used as follows:
for the production of Aβ-1-42 oligomer;
in western blot analysis;
for interference testing of immunomagnetic reduction (IMR) plasma Aβ42 assay;
to study the effect of resveratrol on Aβ-1-42-induced impairment of spatial learning, memory, and synaptic plasticity;
to investigate the effect of Aβ in epithelial cell cultures.
General Description
Amyloid β Protein is produced from amyloid-β precursor protein (APP). It consists of two C terminal variants, such as a long tailed Aβ 1-42 and a short tailed Aβ 1-40. APP is located on human chromosome 21q21.3.
Biochem/physiol Actions
Amyloid β-Peptide (1-42) (human) is a human form of the predominant amyloid β-peptide found in the brains of patients with Alzheimer's disease. Amyloid β Protein Fragment 1-42 (Aβ 1-42) has antioxidant and neuroprotective properties. Accumulation of amyloid β Protein is associated with Alzheimer′s disease (AD) and Down Syndrome. Aβ 1-42 regulates cholesterol transport and may function as a transcription factor. It may possess anti-inflammatory and antimicrobial properties. Downregulates bcl-2 and increases the levels of bax. Neurotoxic.
Storage
-20°C
References
[1] CHEN L M, CHAI K X. Matriptase cleaves the amyloid-beta peptide 1–42 at Arg-5, Lys-16, and Lys-28[J]. BMC Research Notes, 2019, 12. DOI:10.1186/s13104-018-4040-z.
[2] BROWN A M, BEVAN D R. Influence of sequence and lipid type on membrane perturbation by human and rat amyloid β-peptide (1-42).[J]. Archives of biochemistry and biophysics, 2015, 614: 1-13. DOI:10.1016/j.abb.2016.11.006.
[3] MENGTING YANG. Gel Phase Membrane Retards Amyloid β-Peptide (1–42) Fibrillation by Restricting Slaved Diffusion of Peptides on Lipid Bilayers[J]. Langmuir, 2018, 34 28: 8408-8414. DOI:10.1021/acs.langmuir.8b01315.
[4] LIANG SHEN Hong F J. Comparative study on the conformational stability of human and murine amyloid β peptide[J]. Computational and Theoretical Chemistry, 2011, 972 1: Pages 44-47. DOI:10.1016/j.comptc.2011.06.012.
[5] MOUCHARD A, BOUTONNET M C, MAZZOCCO C, et al. ApoE-fragment/Aβ heteromers in the brain of patients with Alzheimer’s disease[J]. Scientific Reports, 2019, 9. DOI:10.1038/s41598-019-40438-4.
Properties of Amyloid β-Peptide (1-42) (human)
| storage temp. | -20°C |
| solubility | Soluble in ammonium hydroxide, pH >9. Also soluble in DMSO. |
| form | Lyophilized |
| color | Lyophilized White |
| CAS DataBase Reference | 107761-42-2(CAS DataBase Reference) |
Safety information for Amyloid β-Peptide (1-42) (human)
Computed Descriptors for Amyloid β-Peptide (1-42) (human)
| InChIKey | XPESWQNHKICWDY-QYFPAAMGSA-N |
New Products
Cyclopentane-1,2-dione 2,6-Dibromoaniline (RS)-beta-Amino-beta-(4-bromophenyl)propionic acid 1-AMino-cyclobutaneMethanol HCl TETRABUTYLAMMONIUM CYANIDE 3-Amino-3-(3-fluorophenyl)propanoic acid 3-Amino-3-(4-methylphenyl)propionic acid 3-AMINO-3-(3-CHLORO-PHENYL)-PROPIONIC ACID Cefuroxime EP Impurity-A N-Nitroso hydroxy Cetrizine EP Impurity-A Noradrenaline EP Impurity D/Noradrenaline Methyl Ether Cetirizine EP Impurity A/Cetirizine CBHP Impurity Lantanoprost rc B Clidinium Bromide Impurity 4 - fluoro- 2 - methoxy- 5 - nitroaniline 1-(2-amino-5-hydroxy phenyl)propan-1-one tert-butyl 4-(6-((7-cyclo pentyl -6-(dimethyl carbamoyl) -7H-pyrrolo [2,3-d]pyrimidin-2-yl) amino)pyridin-3-yl) piperazine-1-carboxylate 2-amino-5-nitrobenzonitrile (4-Fluoro-2-methoxy-5-nitro- phenyl)-[4- (1-methyl-1H- indol-3- yl)-pyrimidin-2-yl]- amine (3R,4R)-1-benzyl-N,4-dimethylpiperidin-3- amine 2-Chloro Benzylcyanide 3,4 Diethoxy Benzylcyanide 3,4 Dimethoxy Benzylcyanide 3-chlorobenzyl cyanideRelated products of tetrahydrofuran







You may like
-
β-Amyloid Peptide (1-42), Rat CAS 107761-42-2View Details
107761-42-2 -
Amyloid β Protein Fragment 1-42 CAS 107761-42-2View Details
107761-42-2 -
TB 500 10Mg Peptide InjectionView Details
107761-42-2 -
10442-39-4 TETRABUTYLAMMONIUM CYANIDE 98+View Details
10442-39-4 -
10442-39-4 TETRABUTYLAMMONIUM CYANIDE 98+View Details
10442-39-4 -
68208-21-9 98+View Details
68208-21-9 -
3-Amino-3-(3-fluorophenyl)propanoic acid 98+View Details
117391-51-2 -
3-Amino-3-(4-methylphenyl)propionic acid 68208-18-4 98+View Details
68208-18-4
