Contact us: +91 9550333722 040 - 40102781
Structured search
India
Choose your country
Different countries will display different contents
Try our best to find the right business for you.
My chemicalbook

Welcome back!

HomeProduct name listAmyloid β-Peptide (1-42) (human)

Amyloid β-Peptide (1-42) (human)

Synonym(s):β-Amyloid Peptide (1-42), Rat;DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA

  • CAS NO.:107761-42-2
  • Empirical Formula: C203H311N55O60S1
  • Molecular Weight: 4514.04
  • MDL number: MFCD00163049
  • EINECS: 761-142-2
  • SAFETY DATA SHEET (SDS)
  • Update Date: 2025-12-07 19:09:50
Amyloid β-Peptide (1-42) (human) Structural

What is Amyloid β-Peptide (1-42) (human)?

Chemical properties

Lyophilized White solid, with no soy flavor, no protein denaturation, acidic non-precipitation, heating does not coagulate, easily soluble in water, good fluidity, and other good processing properties, is an excellent health food material.

The Uses of Amyloid β-Peptide (1-42) (human)

Aβ(s) peptides, their peptide fragments and mutated fragments are used to study a wide range of metabolic and regulatory functions including activation of kinases, regulation of cholesterol transport, function as a transcription factor, and regulators of inflammation. Aβ(s) peptides and their peptide fragments are also used to study oxidative stress, metal binding and mechanisms of protein cross-linking in the context of diseases such as Alzheimer?s disease and neurodegeneration.

What are the applications of Application

Amyloid beta (Aβ or Abeta) is a peptide of 36-C43 amino acids that is processed from the Amyloid precursor protein. Amyloid β-Peptide (1-42) human is a 42-amino acid peptide which plays a key role in the pathogenesis of Alzheimer disease. Beta-Amyloid (1-42) human is used as follows:
for the production of Aβ-1-42 oligomer;
in western blot analysis;
for interference testing of immunomagnetic reduction (IMR) plasma Aβ42 assay;
to study the effect of resveratrol on Aβ-1-42-induced impairment of spatial learning, memory, and synaptic plasticity;
to investigate the effect of Aβ in epithelial cell cultures.

General Description

Amyloid β Protein is produced from amyloid-β precursor protein (APP). It consists of two C terminal variants, such as a long tailed Aβ 1-42 and a short tailed Aβ 1-40. APP is located on human chromosome 21q21.3.

Biochem/physiol Actions

Amyloid β-Peptide (1-42) (human) is a human form of the predominant amyloid β-peptide found in the brains of patients with Alzheimer's disease. Amyloid β Protein Fragment 1-42 (Aβ 1-42) has antioxidant and neuroprotective properties. Accumulation of amyloid β Protein is associated with Alzheimer′s disease (AD) and Down Syndrome. Aβ 1-42 regulates cholesterol transport and may function as a transcription factor. It may possess anti-inflammatory and antimicrobial properties. Downregulates bcl-2 and increases the levels of bax. Neurotoxic.

Storage

-20°C

References

[1] CHEN L M, CHAI K X. Matriptase cleaves the amyloid-beta peptide 1–42 at Arg-5, Lys-16, and Lys-28[J]. BMC Research Notes, 2019, 12. DOI:10.1186/s13104-018-4040-z.
[2] BROWN A M, BEVAN D R. Influence of sequence and lipid type on membrane perturbation by human and rat amyloid β-peptide (1-42).[J]. Archives of biochemistry and biophysics, 2015, 614: 1-13. DOI:10.1016/j.abb.2016.11.006.
[3] MENGTING YANG. Gel Phase Membrane Retards Amyloid β-Peptide (1–42) Fibrillation by Restricting Slaved Diffusion of Peptides on Lipid Bilayers[J]. Langmuir, 2018, 34 28: 8408-8414. DOI:10.1021/acs.langmuir.8b01315.
[4] LIANG SHEN Hong F J. Comparative study on the conformational stability of human and murine amyloid β peptide[J]. Computational and Theoretical Chemistry, 2011, 972 1: Pages 44-47. DOI:10.1016/j.comptc.2011.06.012.
[5] MOUCHARD A, BOUTONNET M C, MAZZOCCO C, et al. ApoE-fragment/Aβ heteromers in the brain of patients with Alzheimer’s disease[J]. Scientific Reports, 2019, 9. DOI:10.1038/s41598-019-40438-4.

Properties of Amyloid β-Peptide (1-42) (human)

storage temp.  -20°C
solubility  Soluble in ammonium hydroxide, pH >9. Also soluble in DMSO.
form  Lyophilized
color  Lyophilized White
CAS DataBase Reference 107761-42-2(CAS DataBase Reference)

Safety information for Amyloid β-Peptide (1-42) (human)

Computed Descriptors for Amyloid β-Peptide (1-42) (human)

InChIKey XPESWQNHKICWDY-QYFPAAMGSA-N

Related products of tetrahydrofuran

You may like

Statement: All products displayed on this website are only used for non medical purposes such as industrial applications or scientific research, and cannot be used for clinical diagnosis or treatment of humans or animals. They are not medicinal or edible.