FOXO4 DRI 5mg/vial Lyophilized Powder With Safe Delivery
| Price | Get Latest Price | ||
| Packge | 1KG | ||
- Min. Order:0.01KG
- Supply Ability:1 tons
- Time:2022-04-01
Product Details
- Product NameFOXO4 DRI
- MW0
- AppearanceSolidWhite to off-white
FOX04 D-Retro-Inverso peptide, also known as FOXO4 DRI peptide was first reported in 'Targeted Apoptosis of Senescent Cells Restores Tissue Homeostasis in Response to
Chemotoxicity and Aging' by Baar et al.
FOXO4 DRI peptide comprising the amino acid sequence:LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues.
FOXO4 D-Retro-Inverso peptide selectively induces apoptosis of senescent cells reverses effects of chemotoxicity and aging in mice.
AAS Raw | |||
| Testosterone Enanthate | Nandrolone Decanoate | Stanozolol | Sustanon 250 |
| Testosterone Cypionate | NPP | Oxandrolone | 1-test cyp (DHB) |
| Testosterone propionate | Boldenone undecylenate | Dianabol | Turinabol |
| Testosterone Phenylprop | Boldenone Base | Trenbolone Enanthate | Methenolone Enanthate |
| Testosterone base | Boldenone Cypionate | Trenbolone Acetate | Methenolone Acetate |
| Testosterone decanoate | Boldenone Acetate | Trenbolone hex | Mesterolone |
| Testosterone undecanoate | Drostanolone propionate | Trenbolone base | Oxymetholone |
| Testosterone isocaproate | Drostanolone enanthate | letrozole | Exemestane |
| Testosterone acetate | Superdrol | Raloxifen | Epistane |
| Methyltestosterone | trestolone acetate(MENT) | Clomifene citrate | Anastrozole |
| halotestin | methyltrienbolone | Tamoxifen Citrate | |
| Sarms Raw | |||
| RAD 140 (Testolone) | S-23 | SR9011 | SR9009 (Stenabolic) |
| YK11(Ligandrol,VK5211) | S-4(Andarine) | Gw0742 | ACP105(ACE-XT) |
| LGD-4033 | Mk 2866(Ostarine) | GW501516 | TLB150 |
| LGD-3033 | MK677( Ibutamoren) | AC-262536(Accadine) | |
| Peptide vial | |||
| GH | Semaglutide | Selank | PT-141 |
| TB500 | Linaclotide | BPC157 | AOD9604 |
| Epithalon | Ipamorelin | Kisspeptin | DSIP |
| GHRP-2 | MGF (Mechano Growth Factor) | IGF LR-3 | Gonadorelin |
| GHRP-6 | PEG-MGF | fox04-dri | Triptorelin/GnRH |
| Thymosin Alpha | Sermorelin | FST344 | Oxytocin |
| CJC1295 DAC | MT-1 (Melanotan 1 ) | GDF-8 | Tesamorelin |
| CJC1295 NO DAC | MT-2 (Melanotan 2 ) | ACE-031 | Adipotide |


Whatsapp / Skype : +86 18986015478
Wickr: Amygodbullraw
Email: Amysales@godbullraw.com
FAQ:
Q1: Do you offer free sample?
A: Of course, we will offer free sample if you pay shipping fees.
Q2: How to solve the quality problem?
A: We supply high quality products and quality issue near to zero. If it happens caused by occasional?case, we will reship again or compensate customer loss, but customer need show us the evidence of problems or test report.
Q3: Whether transportation is safe and whether to reship if seized?
A: Yes, we offer almost 100% Shipping line with safe delivery. If seized unfortunately, we will ship and I am sure no custom issue.
Q4: ETA ?
A: Pack sent out in 2-3 days and offer tracking numbers after payment. ETA not the same decide by destination country. Please contact us for details (always 10-15 days).
Q5: Do you have any discount?
A: The price is negotiable. Plz shoot us your order content, we will quote a fair price.
Q6: What is your minimum order ?
A: Usually MOQ is 100g. But depends on the items and your requirements, we also can support small quantity, such as 20g and 50g.
Q7: How to order?
A: E-mail or message us that includes your order like format below:
product A ? 100g
product B ? 10vials
delivery country:?
Our sales will quote a total cost includes shipping fees and each item fees in 12 hours regularly.?
Our will satisfy your purchase and supply professional guide.
Company Profile Introduction
Company description:
Wuhan Godbullraw Chemical Co.,ltd, founded in 2011, is a modern advanced enterprise specializing in custom synthesis and R&D and exportation of APIs, peptides,
Sarms, Local anesthetics, plant extract etc, we build coopration with labs and factory qualitied with GMP, DMF, FDA in china and worldwild.
We take advantage on integrating factory resources and lab customized projects.for customer demand, we continue to expand the industry chain in familiar areas,
and at the same time we also keep develop new product supply chain.
We have 7 synthesis labs and 3 scale-up labs and 3 analysis lab toatly spaced with 13500 square meters, basement of these experienced chemist with high educated,
we have strong supply system and purity raw. As the shipping , we cooperate with 10 experienced shipping companies to make sure ETA by a safe delivery to worldwild
Our service:
Quality: Our products match CP and USP standard before comes out from factory and rechecked by third institution like Jonashik and scores well always,
we supply test report credit 30$ for next order
Shipping: available to worldwide, ETA 12 days around,customer just only need to supply us ship info and then wait the order delivery after payment,
we will supply tracking number immediately when pack sent out
we experienced on shipping, we can promise free reshipping if seized by custom unfortunately
Payment: T/T,Western union,Bitcoin
- Since:2016-06-27
- Address: #58, Guanggu avenue, East Lake High-tech district , Wuhan, Hubei, China
