Hexafluorosilicic acid
| Price | USD1.00 |
| Packge | 1kg |
- Min. Order:1kg
- Supply Ability:100kg
- Time:2019-07-06
Product Details
- Product NameHexafluorosilicic acid
- CAS No.16961-83-4
- EINECS No.241-034-8
- MFF6H2Si
- MW144.09
- AppearanceLiquidClear colorless
- density 1.22 g/mL at 20 °C (lit.) 1.31 g/mL at 25 °C
- storage temp. −20°C
- Boiling point 108-109°C
- Water Solubility Miscible with water.
| Product Name: | Hexafluorosilicic acid |
| Synonyms: | SILICOFLUORIC ACID;SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF;SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE;SER-TYR-SER-MET-GLU-HIS-PHE-ARG-TRP-GLY-LYS-PRO-VAL-GLY-LYS-LYS-ARG-ARG-PRO-VAL-LYS-VAL-TYR-PRO-ASN-GLY-ALA-GLU-ASP-GLU-SER-ALA-GLU-ALA-PHE-PRO-LEU-GLU-PHE HUMAN;HYDROGEN HEXAFLUOROSILICATE;HYDROFLUOROSILICIC ACID;HYDROFLUOSILICIC ACID;HYDROSILICOFLUORIC ACID |
| CAS: | 16961-83-4 |
| MF: | F6H2Si |
| MW: | 144.09 |
| EINECS: | 241-034-8 |
| Product Categories: | Acids;Electronic Chemicals;Micro/Nanoelectronics;peptide;Fluoride;Inorganics |
| Mol File: | 16961-83-4.mol |
 |
|
| Hexafluorosilicic acid Chemical Properties |
| Boiling point | 108-109°C |
| density | 1.22 g/mL at 25 °C |
| refractive index | 1.3500 |
| Fp | 108-109°C |
| storage temp. | −20°C |
| solubility | H2O: 1 mg/mL, clear, colorless |
| form | Liquid |
| color | Clear colorless |
| Water Solubility | Miscible with water. |
| Merck | 14,4182 |
| Stability: | Stable in aqueous solution. |
| InChIKey | AUJBMDCSBIPDEH-UHFFFAOYSA-N |
| CAS DataBase Reference | 16961-83-4(CAS DataBase Reference) |
| EPA Substance Registry System | Silicate(2-), hexafluoro-, dihydrogen(16961-83-4) |
| Safety Information |
| Hazard Codes | C |
| Risk Statements | 34-35-20/21/22 |
| Safety Statements | 26-36/37/39-45-27 |
| RIDADR | UN 1778 8/PG 2 |
| WGK Germany | 3 |
| RTECS | VV8225000 |
| F | 8-10 |
| Hazard Note | Corrosive |
| TSCA | Yes |
| HazardClass | 8 |
| PackingGroup | II |
| HS Code | 28111990 |
| Hazardous Substances Data | 16961-83-4(Hazardous Substances Data) |
Company Profile Introduction
Henan CoreyChem Co., Ltd, based on the original Zhengzhou Cote Chemical Research Institute, be brave in absorbing highly educated talents & overseas returnees; actively responded to Zhengzhou City High-tech Zone Government’s Special Care Policy, reorganized and founded in National University of Science and Technology Park, which is a high-tech, stock enterprise of high-end chemical Custom synthesis;The park was created by the People's Government of Henan Province, and proved by Ministry of Education and the National Science & Technology, taking the construction mode of "many college a park, and common development", mainly depends on Zhengzhou University and Henan University’s scientific research and talent advantage to set up Universities, scientific research institute and enterprise scientific research achievements transformation platform, to make high-tech enterprises incubate, is the new high-tech talent gathering base, high and new technology industry enterprise radiation base, colleges and universities technological innovation base.
Henan Coreychem Co., Ltd, facing global High-tech pharmaceutical raw materials, high complex new type intermediates, fine chemicals custom synthesis, scale-up production and Rare chemicals trade. Corey have well-equipped machine, strong technical force and considerate marketing team service. We also have rich experience advantage in basic research, small scale process development, scale-up, industrial technology development & production and cost control.
Recommended supplier
- Jay Intermediates And Chemicals
- Fluosilicic Acid, Packaging Type: HDPE Carboy, Packaging Size: 40 Kg
- Inquiry
- 2025-09-23
- Fengyuan India Private Limited
- Hexafluorosilicic Acid (Industrial) 23%&40%, Packaging Size: 1100kg/Ibc Drum
- Inquiry
- 2025-09-23
- Ganesh Enterprise
- Fluosilicic Acid Liquid, 99%
- Inquiry
- 2025-09-23
-
VIP3年
- JSK Chemicals
- Fluosilicic acid 99%
- Inquiry
- 2025-03-05
-
VIP0年
- JSK Chemicals
- Fluosilicic acid 99%
- Inquiry
- 2025-03-05
- Since:2014-12-17
- Address: No.967,15th Floor,Unit 7, Building 1, No.70 of DianChang Road, High-tech Development Zone, Zhengzho
INQUIRY